SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002837 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002837
Domain Number 1 Region: 34-88
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000464
Family Myb/SANT domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002837
Sequence length 170
Comment protein Name="PYU1_T002837" Note="Similar to mybJ: Myb-like protein J (Dictyostelium discoideum)" AED:0.351131746952989 QI:0|-1|0|1|-1|1|1|0|170
Sequence
MTISKHVKDQYFLNEVQVIRIAPLQSNANATESSRRSGRPWTQDEHNRFLEALENYPTGP
WKTIALCVGTRTTRQTMSHGQKYREKIARRKRRMTTFSSFAVDPFPTVLTTSSAELPRLP
QLGAPASSVHHYSSKITTYQRDDQEGDCPRFQRATNSFIGLGENDRSQGN
Download sequence
Identical sequences K3WCZ6
PYU1_T002837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]