SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002842 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002842
Domain Number 1 Region: 68-122
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000822
Family Myb/SANT domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002842
Sequence length 319
Comment protein Name="PYU1_T002842" Note="Similar to mybJ: Myb-like protein J (Dictyostelium discoideum)" AED:0.2421875 QI:0|-1|0|1|-1|1|1|0|319
Sequence
MTISKRIHNQLFASKPAASTAESTLLDVPASPIAVDEVEKQLIRLPLTHSRTGASKRASR
ANKKPAVRHSGLGWTDEEHERFLQGLELFPTGPWKQVAAYVGTRTTRQTMTHAQKYRQKI
ERRQRGLMIPVRKPSSIASAVGARKASPTASKNSNQRQSDTPASPNEAQADAPVTTGQKS
PSIFNTSSASSPSSAEQLVREIDFDLDFLDVNAKVHADSTWYQTAVIGHSEAMSIAMGDN
EQELIPLSLDETVQCSFMTDVHDPIAAMFEDPSNCLASESWQQQRFAPNVPWRSTVSTTP
ASTEIIYDMLPPPPYEFYF
Download sequence
Identical sequences K3WD01
PYU1_T002842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]