SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002876 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002876
Domain Number 1 Region: 5-443
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 8.89e-103
Family Aconitase iron-sulfur domain 0.0000302
Further Details:      
 
Domain Number 2 Region: 494-668
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 1.92e-36
Family LeuD-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002876
Sequence length 708
Comment protein Name="PYU1_T002876" Note="Similar to leuC: 3-isopropylmalate dehydratase large subunit (Campylobacter fetus subsp. fetus (strain 82-40))" AED:0.00493653032440056 QI:0|-1|0|1|-1|1|1|0|708
Sequence
MAETKIPPMNVIEKILCHHAVGLQQPFVTVGDVVCVQADWTIASELTFQAMDVMHKSIGR
PKLHRPDRFWLALDHTVDPRVNDQPKQQALIKLSSDFAQEHGLTDFWGPNTTIMHTEFAR
KRAQPGQIVIGADSHTCSAGGMGAFAAGLGAGDVVMPLVTGQTWFKVPEVAYIEFVGEPA
FGIGGKDVILHILGELKRNTVAFERCVYYGGEGLKHLSDDARFAIANMSTEFGGIAGVFE
ADEITQRVLEGRDSHFDEALFFRADEGCNYAAHHVINLADVKPLIAMYPSPDNCVKVSEK
IGMELDGCFIGACTTTQEDLILGALVLQQAMLEGKRPSPKGHRRVTPGSLEIIARLKELG
FVRIYEEAGFTVGVPSCSYCVGIGADVAGENEVWLSSQNRNFRNRMGKGSIGNLSSAAVV
AASSFDMTVTDPTPYINKISKEDFNRYRNWLDAPVDPAKPTFTVVEPKPVLAGEGDQDVQ
IAQEQAAVAAIESELPPLFKGKAQVFGDNIDTDAVIPAQFMGLNKESPLWPKECETELEV
LASKSFAYVKPEFPQKVREGFNIIVAGTAFGSGSSREEAAICLKAVGVQAVIAKSFAYIY
ARNQPNNALLGIVVTDEKFHELAQEGEEVTVDLRNRYVSVKDHKVMFTLTQVEENFLNGG
GLKSLFKKYKADLFRAAMRGKAPTPISSSGVGCGPDAGCGTDTASVSW
Download sequence
Identical sequences K3WD35
PYU1_T002876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]