SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002885 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T002885
Domain Number - Region: 40-122
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000129
Family Canonical RBD 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002885
Sequence length 260
Comment protein Name="PYU1_T002885" Note="Similar to RRP7A: Ribosomal RNA-processing protein 7 homolog A (Homo sapiens)" AED:0.0235491518118285 QI:0|1|0.66|1|1|1|3|19|260
Sequence
MAQVVGGYHAIALPLAHSAFKRYIYVKKHNVKENETVGGESQLVADRTVYVVNLPAHADE
HWLRACLEPAVGSIQHVVNAKTAGTSNSNSNGNSSGGAQDPLMAKTAHVVFKSKDAVKKV
LQVKQLAMSDNEAPATGLQAYLNKYRANKPGLAAVKAIADKYMAQFDADEEEDFRKREEL
KAQVDDDGFKMVVNTKKRTQAAADDLGRPAKKQKSKEMDNFYRFQMRERKRDQLKSLRER
FEEDRQMVEKLKLANKFKPE
Download sequence
Identical sequences K3WD44
PYU1_T002885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]