SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002940 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002940
Domain Number 1 Region: 97-172
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000442
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Weak hits

Sequence:  PYU1_T002940
Domain Number - Region: 223-267
Classification Level Classification E-value
Superfamily ARM repeat 0.0115
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002940
Sequence length 406
Comment protein Name="PYU1_T002940" Note="Similar to PSH1: RING finger protein PSH1 (Saccharomyces cerevisiae)" AED:0.246607269971756 QI:0|0|0|0.5|1|1|4|0|406
Sequence
MTDDATAGDNGAAVITIADNEPTSQLQALDAAVIDVSAAAEEGKRNDDDDDDEVEVIDDA
DTTAAANAQHAGTAAEQTAAPGRTKYEDVVLRHARNAKKLEEELQCVLCHDGLFKPVTAT
CGHSFCRVCLVESCLSRALDEAQCPVCRADVMSHFSENTPIVFHVNVTLWNLIQLLVPRE
EHKDYEHEEQEYTLKLDQLDAKWRIQSLRAAAEHFHREREGTILGTLDDDEDEDYVEGED
DEGDDDEDDSNDDDVDIEGEWYQDDDDEEGARRGGSFANSRRRQRQLEERRRSRQQRNRY
PELKVENMVDGRLRVTRNVLLDTEDANEDGIISMRVGLALVEFPSILELYSEHQECSLAI
LKMEEDEEMDTGFPFFMNESGDDDALVISDYSNEITLKVFDDGVRG
Download sequence
Identical sequences K3WD99
PYU1_T002940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]