SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002943 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002943
Domain Number 1 Region: 216-347
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.57e-23
Family Synaptotagmin-like (S variant) 0.046
Further Details:      
 
Domain Number 2 Region: 1286-1386
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.28e-21
Family Synaptotagmin-like (S variant) 0.015
Further Details:      
 
Domain Number 3 Region: 31-139
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.71e-18
Family Synaptotagmin-like (S variant) 0.026
Further Details:      
 
Domain Number 4 Region: 1421-1550
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.08e-18
Family Synaptotagmin-like (S variant) 0.02
Further Details:      
 
Domain Number 5 Region: 401-507
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000185
Family Synaptotagmin-like (S variant) 0.011
Further Details:      
 
Domain Number 6 Region: 797-915
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000268
Family Synaptotagmin-like (S variant) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002943
Sequence length 1743
Comment protein Name="PYU1_T002943" Note="Similar to myof: Myoferlin (Xenopus tropicalis)" AED:0.0999652886098891 QI:0|0|0|0.71|0.83|0.71|7|0|1743
Sequence
MDPFEELARAPVELQAKEISLSGEADDKLPNTLVVTVLQARGLHAAPLRSTLSCYVKLSS
LGREFKTSVISKSDEPYWNESFSFRAVDWASSVTLSVRDKINVKMRALGQVKISSADIAN
LPGMSCQSWFKLTDKNGERKDGMDSEIELKVALIYTTKHDPSIASEIAATTDKEDALLLG
VIADQDDETEEEAFVRRKELERQEKERKSTLYSNLKHGDYQIQVHVIEARDLKGENLSGT
SDPYCQVEVMGLKKKTSTKYETLGCVFDEILFFHSTNIGRNELKQATIKISVWDKEKVMK
DNFIGGYQLDCLSVHFRPHHELYRQWIAIHDHLNEKDRGIQGFLLVSISVIGPGDVLRVH
DRDAEIAKELATSAASLQGATPSDMISTDTSHSVVLMPPTIDLKLHFLLVKVFRAEDLPP
MDEGGLILSSGIDAFVQIGFASNSTCKSSVVTVKGTSNLSPEFLEELWIPVLAPTLSRNI
VISVWDRDLGRKDEVVGISSHDYLQVPSSTCRGGILASAIETRGKASLSERDKDMSMDTE
EAQDEERVEPRWFNLYGPPLRRANKKRATMICQNPELGSTYRGRVLLSMEKVESPMSSES
EKFHTKRMKDAPSANTSGAKSSKTIKYVLRCALFCGADIPQFHSIASTKTKMRVTVSIGS
YEIHFDSQPVRKDGRVDWEQCKERWPIILPADLTQLPDLIITLSRQLEKDDFVGVSFVRA
PAADFFVKGFNAKTEWIHLEEDMSRRQTKYALDKTQSPGSLLIRVGFGREEIAVRYPWGD
ETELFAPFRNLSVHREIRVHIFQFRKLVIPQGKMRLPNPFVSVTCCGQTKKTAPKYKTLD
PLFYESLVFMVHVPTDVVFTPDLVFRLHDANVSTSTEVPAGIFGELTVSMSKAVKSVANA
SVPRPSWYQLQMRNSSFSSPLIDEVKGEALISIQFVDHPGPTEHSQRLDPLTPAYEDATL
EIVALGVRKLKALSALGVQRPHMEFELIGGMFSDGTHVRKSKPTKLPIDTLFAPQLRIKV
CESSLGGLRKATIASCVVDLSAKLPWSIEYVPPQQQHAFENPMAAPAFTTDATEKSKHKM
RFPVLKISKQRKVTGIQDAGTLKDPDDLLSDDEEDDESEKVSQIHDDGIGIGSLRLPEIS
LSKPSRSQLSDPALLNQWKSEEQRRYLAGRADMLQGGAQGHGGGGENTLHDNNADSDTMH
KPAPYLAGRDWWITDHSGEELEYFLEGKALETYPLYRFVLTRPSLLKRKRVRTELKAGLF
KGLISITQQKKKLTKTHSLLDIERLQEPQSLVVRVYVLRGSNLQSKDSNGYSDPYLRLKL
GKSIISDRANHKKKTLNPDFFRMFSFNTTLPGPSQLEIGVWDHDLVLDDFIGSTTIDLED
RWFHKEWQRIGQGHPQLKEAGGCLKPIEYRHLYTSKRSTSQGFIQLWVDIMTAQQAAVLP
PVNVDPPAPKKFEVRVIIWRAENITDKDNSEINDYFVKAWMEGGKADSTDVHWRCSSGKP
CWNYRFKFPVEYPLRTPEFGRLHIQLWDKDVLKWNDILGEAQLDLYKWIRRAYENNRIVS
PFLELKAMAKAATAEPGKFKKPTFLKKLPADTVKRARKAKEEAEAKAALNGLLGRIGISV
QIVPELEAQMNPVGKGQEAPNMNPYLPPPVGRMRLSANPIMMLKELVGPKMCLRVTILYC
CVGCAFFIGVFGATIMSTLTYFQGMSRGDMSSEQAPWHLPNDFRYPRNFQDPENATVVAG
GGA
Download sequence
Identical sequences K3WDA2
PYU1_T002943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]