SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002955 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002955
Domain Number 1 Region: 20-102
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.25e-24
Family Canonical RBD 0.0000366
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002955
Sequence length 124
Comment protein Name="PYU1_T002955" Note="Similar to SF3B14: Pre-mRNA branch site protein p14 (Homo sapiens)" AED:0.132558823529412 QI:0|0|0|0.5|1|1|2|0|124
Sequence
MAAMATQGRRGNARLPPEVNRILYVRNLPFKISSEEMYDIFGKYGAVRQIRLGVNNDTRG
TAFVVYEDIYDAKNAVDHLSGFNVCGRYLIVLYYQANRMQTKKGQDVEKQKQELQDLKQK
YGVE
Download sequence
Identical sequences K3WDB4
PYU1_T002955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]