SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002957 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002957
Domain Number 1 Region: 82-229
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.39e-17
Family Ribonuclease H 0.0032
Further Details:      
 
Domain Number 2 Region: 5-50
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.00000000000575
Family N-terminal domain of RNase HI 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002957
Sequence length 238
Comment protein Name="PYU1_T002957" Note="Similar to rnh1: Ribonuclease H (Schizosaccharomyces pombe)" AED:0.0502092050209205 QI:0|-1|0|1|-1|1|1|0|238
Sequence
MGGTKYYAVVNGRFSTGIFTTWEETAKQVIGFSGAKYKSFPTYQEAKEYYLANGGAAEDV
EDLLQKKMKELTVNSEDPASTLVAFCGCSAHGNGTLNCEAAWACVFPNHSEWNVTKKMDD
DEKPTNNRPVYLAALEALRRANVEDPERDQVLTVFTNLEILVDSMTKLAKEWEENNWVKS
DGKLAKNVDLLKLLLDEQKNRQVQWKHVESEWELSCMDIAKELAQNAVHGSGQFSSDE
Download sequence
Identical sequences K3WDB6
PYU1_T002957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]