SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002976 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T002976
Domain Number - Region: 145-276
Classification Level Classification E-value
Superfamily Bet v1-like 0.00126
Family STAR domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002976
Sequence length 362
Comment protein Name="PYU1_T002976" Note="Protein of unknown function" AED:0.0964187327823691 QI:0|0|0|0.33|1|1|3|0|362
Sequence
MRKFSCDRYFPRELEFSSEEKAQYLRLVQELVHETLDEYAEYRTVPYDATSTKPLSTSVL
DPLEWKEMNRNGGLTVYKDCKKPGAKTKPNRQNLRRPGGGHEVVESKWPIPTMLTLGHIS
GRLHDTMYGAFVDSDDGFRLRSSYLDDDLDDVKILHKFEGPSIDDPFRFCGIVWYVYGHI
LSPIMRRRDNVLLVAMGMTRSREGDRIGYHVMHSVDIPALRPLTQYKIERAYGSMVFVKR
QWDDQRVEMFQKGFFTPKGDIPDFAIGNAVMKGILRCGNATVEASLSKKLYWMMQDTARA
RKRRCVTFARNTSALTVATREFLEQDCQVMLSSFRSVRSDGSTDPTASLQPQRKAHVLWQ
PE
Download sequence
Identical sequences K3WDD5
PYU1_T002976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]