SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003002 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003002
Domain Number 1 Region: 20-100
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000291
Family 53BP1 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003002
Sequence length 138
Comment protein Name="PYU1_T003002" Note="Protein of unknown function" AED:1 QI:0|0|0|0|1|1|2|0|138
Sequence
MVDVRVGQDAQIDCSDVVAGKMVELGAVIVKRFTPRVTHIVLSQLTPVWKDKIAKWSSNV
SMSLVRQRDGKGELQIVSQLWVNACYVSKTRMDEKPFFPRELGNDSTGDDDDNGGGGGHA
QEYSDNDATTVLQEQQRH
Download sequence
Identical sequences K3WDG1
PYU1_T003002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]