SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003003 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003003
Domain Number 1 Region: 519-614
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000000301
Family BRCT domain 0.0074
Further Details:      
 
Domain Number 2 Region: 628-705
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000209
Family DNA ligase 0.039
Further Details:      
 
Weak hits

Sequence:  PYU1_T003003
Domain Number - Region: 268-293
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00392
Family Ran binding protein zinc finger-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003003
Sequence length 720
Comment protein Name="PYU1_T003003" Note="Similar to sraP: Serine-rich adhesin for platelets (Staphylococcus haemolyticus (strain JCSC1435))" AED:0.122052704576976 QI:0|0|0|0.25|1|0.75|4|0|720
Sequence
MASDSIQKLLAADASASAATPQKEENESNGAKKKLEMDAISTPEAVGVRGRRSMSSAKRR
KTISAIPHTPNPKTVPSVETSNTQKALFHDDAASECVADSQSEVDEAQSKQPSSATLQFS
DDSIVPSSVTSSVSTNVVSDTVEAAAVRASSGSPNGTDNAALGAMTETVTNGNAGPTTKV
ADVPFDKSKPEATTNATDSAQVDIVDLTVLSSATSSGTSQIGKPDKVLKATSTPATSTPA
TSTPATTVVATKSVGAPAKAKAPAAPAIWACTKCGCTNARTRRLCKDCRTPKTAFDALRA
ETPEVAKKPAAPIPKVPSAATRASRTTTPAVPVAPKTPVVTAATTRRILTTPKTLTRPAL
SASRRQLTTPVTLSKSAARKLPLGAPKSPPRPLSALSDRHTQGSSQMSISSGSSVSVLEM
TPVRVPERPGSKRSLYTSGSESGAKRQRLSEMKSSPSQRVIDLSNEQKVNLDRSLDRLAT
PRQSTSSRRSRSIGTSTPVKTPVKTPAAVKSARPTRSVIGITGVDMETRGVIECAVHAID
ATMVTESGYRKARVVKSVDYAAAVTHLIVGEDTKRTIKVLFAIARGAWIVSEAWVFSSLE
KEQWLPEEDFELDMFSNKYARMHPEERQIFKSMKFFVGSNVEPSREVLQSLLQSAGGEIC
NQISVADMVICGDGSLFRRAQRTGIRVVTAKWVFDSIGAMKLEDDVKYGLSTTSTSLEDD
Download sequence
Identical sequences K3WDG2
PYU1_T003003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]