SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003016 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003016
Domain Number 1 Region: 65-188
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000000128
Family Synaptotagmin-like (S variant) 0.012
Further Details:      
 
Domain Number 2 Region: 1171-1275
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000018
Family Pleckstrin-homology domain (PH domain) 0.0052
Further Details:      
 
Weak hits

Sequence:  PYU1_T003016
Domain Number - Region: 909-978
Classification Level Classification E-value
Superfamily ARM repeat 0.0936
Family Clathrin adaptor core protein 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003016
Sequence length 1362
Comment protein Name="PYU1_T003016" Note="Similar to VTG2: Vitellogenin-2 (Gallus gallus)" AED:0.0335854725953786 QI:0|1|0.33|1|1|1|3|115|1362
Sequence
MSAPVSPRSLNADSWNQLSQATREFGDQYGVSLNRAGGSPSKRASPRFLRSMFEPSAAAA
DAECLFRVRISGIQCRNLQGRKFSGKSDPFVEFYWDDPDEKAPYATPVIKADLNPNYKGL
LIAFEYKATLSLLPKKLLVAKVFTHRKFHAKTMIGCAQVDLWSVATGPVHHDHHLIGCDN
GRIVFNCYMEQCSEWNISVSDVGVMMPAIANELDRPEGHDFQEDASLPLKKFAVSYKCTI
GTSEAFYMGNNLKHAEKRVMAEINDVSFQSLARLAVLSSRVSRPNSQQLSSAAAASDDDF
ADPLVAEDPVGVQWSTATDHLPAITRYSTFDELMSATLTLEIRQLCVGRGQIATDPDGGF
LTLLDKYNRETAVVASQDPRFEEEIRNTLLFGQTWLSLEKIFEDALQERIKKKFDADPTL
GLNGLGFSEQFVTSKFEQSLTLKGHQVAVVYGTILFKKIPDVRQLRCGVISENGISSSSS
VIVGVPTSKKPARKSKVVIPIEAQRVLEKMQDLVELMSVRQKDDKEGKVRKATKILKMLQ
ISHKASMLSWVYASTEALDETKSILLRLWQFLLENIRVRHYTLRNVFYELLFYLVKRAEL
SDLPLLGFDSSVVTNAAMFKQSHKVNKRDLEFGLKLRAMLVETKFCVLQTVSVRGVMNNN
LMFFVARMLSVLCFRLPSFGVELYQLWADSYMEDIQNLAEFQVHANADLFAMDGLEAHLD
WRRFHKAIYDEYGEKVLKKQEEEAEDKYEITSEAWKSRFRRLNGEANTLNILLVDQWLWY
VLDTLAVLNQKIGWVHLPGYAQVLKVFFLELKTQKSGWLPPTLYKLSCTMLSNPNLINPM
TKFLLSSTNVHDVTAVIGSVELLGVWMYMIRSWRVRLGSYRLSHLENNDRWNFHQDDQYS
IPAGDEVSLLPPSFDFRFLCSALRILLESEHTQVVLTTLEFLYNCWDCFPERHADKLRYE
LLRSFTRLFLHWHREVRHFFHTLIAFRAMKPHGWNQKGASFVNTPPHSRRQIDAVAADFN
SSLGREEAPDNTTKRTRSYSASNLIESVSKRFTASSPRSSPRSSPAPSPRASGSGLSLTI
SSPSNRAVSSSGNSTPTSGNSFSNSLSDRKTRSISEDFNKLPLQPQPKMDPNIQLQFNRL
LESIYAAAKKYIDQQAHDGSLLRTKQPLKATWKKKGVLLKQGFIYKNTWKQKFFSLQNNK
LGYADTENGPIKREINVIGSVVTELANQIDQSQGSRVVLFNCFQVDSGYQKFTLCAPTYE
DQREWIEVLTQNATAETAVKKPDEQLSQMDVAEVTGKLESLAGKHDAAEAISDSLLPYSA
LAVKEWLQFRVDAMDIESRIAAGLPFQMPVLLSKSSLYADDD
Download sequence
Identical sequences K3WDH5
PYU1_T003016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]