SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003035 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003035
Domain Number 1 Region: 109-198
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.75e-24
Family Canonical RBD 0.0077
Further Details:      
 
Domain Number 2 Region: 8-103
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.31e-24
Family Canonical RBD 0.0022
Further Details:      
 
Domain Number 3 Region: 212-241
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000406
Family CCCH zinc finger 0.0044
Further Details:      
 
Weak hits

Sequence:  PYU1_T003035
Domain Number - Region: 452-475
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000113
Family CCCH zinc finger 0.0056
Further Details:      
 
Domain Number - Region: 406-430
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000196
Family CCCH zinc finger 0.0042
Further Details:      
 
Domain Number - Region: 350-372
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00034
Family CCCH zinc finger 0.005
Further Details:      
 
Domain Number - Region: 275-297
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000471
Family CCCH zinc finger 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003035
Sequence length 549
Comment protein Name="PYU1_T003035" Note="Similar to gar2: Protein gar2 (Schizosaccharomyces pombe)" AED:0.0160025789813024 QI:0|1|0.5|1|1|1|2|0|549
Sequence
MSDGDLWRDRNKVFVAGLPPHVDDNALYEKFKMFGEMHQSKVVYDQKTGRSKGFGFVTFC
EYVHALEAVDNLNQSKWENRVLNVRFLQPKNGAAAGGSGGGPPMISNKPPKVIGPRPEGC
TTIYVGNLAYDITEDVLRKVFEKCGTVKAIRFAEHIQTKEFRGFGYVQFYEEAPCEAAVK
FDGMIVMGRPMNIDYGSRDEVSAKAREDLTKKLKKGICNKFQTGECDRGDDCKFAHVLKD
QDAELLIQPADRPVGAASYAEAAAAPAPLNNANSDAPVCINFQKGKCKRGDACKFQHLGA
EAVAVAAAAHTSAPVVAPTPVRAPRQEDAYDETPSHNEEPEEEATNADADAPVCQNFQKG
KCKRGSACRFRHVAATKESTASYKQSSANQWAAPARVERPAAIVADVAVCQNFRRGRCNR
GASCRFAHTGDVQQAAAAAVVEEVSFYQKRFQSICYNWQKSASCARGDNCPFQHEGGPEP
AARAAHGGDHKEEEAPEEEEDVSVAKKDKKKEKKSKKRKASECESEDEEKVKKEKKDKKK
KKKKDRSED
Download sequence
Identical sequences K3WDJ4
PYU1_T003035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]