SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003093 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003093
Domain Number 1 Region: 64-117
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000254
Family Homeodomain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003093
Sequence length 298
Comment protein Name="PYU1_T003093" Note="Similar to mybJ: Myb-like protein J (Dictyostelium discoideum)" AED:0.239130434782609 QI:0|-1|0|1|-1|1|1|0|298
Sequence
MTISKRVQKELFSAAPAGLLPPHQELQIAAVASVAPRGKKKQQVKGPKLSKAERALAAAI
ADENKGKAWTDEEHARFLEALKEYPSGPWKAIADFVGTKNSRQTMTHAQKYRQKHERRTR
GLRNRSKQRKASARAAAAKAKHAAPPPATAAPSTSTAFSTRTRSQTMMSVQVNDDIVMAS
TPEKHVHACAAQSSDSPRSSEEASTGIGITYVSSPLASVSVATVDAAIADEDTASWEQLK
VSSLSEMFQDFEPMSFFPTVWSTNSLGGDVDAIVTSSYGTNELFCDSASSLNPLSLWG
Download sequence
Identical sequences K3WDQ2
PYU1_T003093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]