SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003094 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003094
Domain Number 1 Region: 35-86
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000972
Family Myb/SANT domain 0.04
Further Details:      
 
Weak hits

Sequence:  PYU1_T003094
Domain Number - Region: 73-119
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 0.00248
Family Oxysterol-binding protein 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003094
Sequence length 220
Comment protein Name="PYU1_T003094" Note="Similar to mybJ: Myb-like protein J (Dictyostelium discoideum)" AED:0.244343891402715 QI:0|-1|0|1|-1|1|1|0|220
Sequence
MSATATRPAASEVALLQLQQTQRRNERRRLSAEGLGVWTKVEHARFLEGKRLFPNGPWKR
VAEFVGTRNTRQTMTHAQKFRQKLERRQRGLRTTRRISDDDHESDEFCNNDTNTTTDEMH
ASSEDIDIETAQVHTPRATTHAHIANDDSTTLRFVSFEQLLKDSTVDIEPACYGYSDGTA
ASTGSSRKYAAESSASPTHHGDPELPWLDECLDFFIHNLS
Download sequence
Identical sequences K3WDQ3
PYU1_T003094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]