SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003099 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003099
Domain Number 1 Region: 29-78
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000972
Family Myb/SANT domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003099
Sequence length 330
Comment protein Name="PYU1_T003099" Note="Similar to DDB_G0271670: Uncharacterized protein DDB_G0271670 (Dictyostelium discoideum)" AED:0.0934066361526393 QI:0|-1|0|1|-1|1|1|0|330
Sequence
MISPQVIQELLTVRQVLHYLPASPKTEKGWTAHEQQLFWDALSKFPQGPWTTIAEFIGTK
STRQAMTHGQKLRQKLNRWRKRLRRTPAAALALSDADTEDDLAATLALTSVMMTSSVIPP
AMMQNTSPVETSMAMAWSMAMPTMMTTATSGTTTSSSFSTQGVQVDDVSVLSPAKTSSRA
SNPSFNYSTMTTCAGLSLPADVLSQVDADYTEFFMASLPFASSGTTTFASSAQSPLSSIS
MSSSGFNRTIDTMASTTPTPTVPSSFVSSGRLAGTHHFDHQQPRHAAYTQASRRAAPRST
PSASTLFINDVHYVLPQAMVDDLTDVLWDY
Download sequence
Identical sequences K3WDQ8
PYU1_T003099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]