SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003102 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003102
Domain Number 1 Region: 24-72
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000012
Family Myb/SANT domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003102
Sequence length 246
Comment protein Name="PYU1_T003102" Note="Similar to F54F2.9: Uncharacterized protein F54F2.9 (Caenorhabditis elegans)" AED:0.268444304628515 QI:0|-1|0|1|-1|1|1|0|246
Sequence
MVELHQAKLVPTQFTVTKPGEHAWSSAEQRRFWEAIHRFPQGPWTAIAAYVGSKSTRQAM
THAQKLRQKLSRWKRRVRNGTESGGSSGGSSPRSELNEYDDDDALGDINEEDDMSDCVVK
AEDMAAMQQHGATFSPDDVAHHDNDAYLDDLLSDIEPVLENVVNFASSPKSEYTATDAMI
QHPSSFASVDMMHATESKPSFEEMGASSSSYFASYQSVSWHVMDHAQHHEVAAPHEYAAA
PIGFRP
Download sequence
Identical sequences K3WDR1
PYU1_T003102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]