SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003106 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T003106
Domain Number - Region: 92-160
Classification Level Classification E-value
Superfamily Bet v1-like 0.0147
Family Atu1531-like 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003106
Sequence length 184
Comment protein Name="PYU1_T003106" Note="Protein of unknown function" AED:0.307291666666667 QI:0|-1|0|1|-1|1|1|0|184
Sequence
MKSFFAATATVASTISAVSGLTYVDPAAAEYFQSATGNVIEIIQEVNGTTGAVWDDWLQK
VWIGSNTIATPGVGRGMVGLGRNIASYHAVETITGAALPVDDVSKIPTITYTVTTFGGFP
WTAHTGFVQFIPTDGGKKTTLNWSNKTTPKKNADGTTYDDSALRAYITTAVTAQVKSWAE
AYKQ
Download sequence
Identical sequences K3WDR5
PYU1_T003106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]