SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003123 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003123
Domain Number 1 Region: 76-143
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000137
Family Centromere-binding 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003123
Sequence length 168
Comment protein Name="PYU1_T003123" Note="Similar to PDC2: Protein PDC2 (Candida albicans)" AED:0.0240880545920334 QI:0|0|0|0.5|1|0.5|2|0|168
Sequence
MARGRGAGAGGNLSNEEKLRLCAFAQENPTMNQKELAAWAQRAFDLAKAPCQSTISNTLK
KRAALQAMRATELACKRRRVLKHPELDRALGNWVLYCMHKGLKVSGDLIKKQAATFAALL
QSPDANDMAFSNGWLTGFQDRHGIRSQRKAVAAAAALTQPVSAAGVTV
Download sequence
Identical sequences K3WDT2
PYU1_T003123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]