SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003140 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003140
Domain Number 1 Region: 2-134
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.71e-45
Family Cold shock DNA-binding domain-like 0.00000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003140
Sequence length 138
Comment protein Name="PYU1_T003140" Note="Similar to EIF1AX: Eukaryotic translation initiation factor 1A, X-chromosomal (Homo sapiens)" AED:0.0463636363636364 QI:0|1|1|1|1|1|2|82|138
Sequence
MPKNKGKGGKNRRRGKNDNEENKRELEFKEDGQEYAQVVRMLGNGRLEAYCFDGVTRLGH
IRGKMRKKVWVGAGDIILVSLREYQDGKVDIIHKYNADEARSLKAYGELPDNARINETTV
DMAMEGDDDDIGFEFDDI
Download sequence
Identical sequences K3WDU9
PYU1_T003140 EPrPI00000023801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]