SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003141 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003141
Domain Number 1 Region: 25-97,243-320,1094-1354
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.44e-25
Family Calcium ATPase, transmembrane domain M 0.014
Further Details:      
 
Domain Number 2 Region: 646-721
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 0.00000698
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0067
Further Details:      
 
Weak hits

Sequence:  PYU1_T003141
Domain Number - Region: 861-934
Classification Level Classification E-value
Superfamily HAD-like 0.000185
Family Meta-cation ATPase, catalytic domain P 0.043
Further Details:      
 
Domain Number - Region: 131-169
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.00106
Family Calcium ATPase, transduction domain A 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003141
Sequence length 1376
Comment protein Name="PYU1_T003141" Note="Similar to Kiaa0195: Uncharacterized protein KIAA0195 (Mus musculus)" AED:0.0784313725490196 QI:0|-1|0|1|-1|1|1|0|1376
Sequence
MVVARRRLLQAIEHQIREKEKSTNFTQEFRDPFSLLLVICAIFRFTDYARKANEDTLAPF
FEGTFLVAAATLNILLNLTQKRRHHEEMAERVRVAVQNMVDTARSEGDETSPRRTWIGGA
KPTLLLPSTSYVACYRDNQWQRIPMNLLVEGDVVGLMSGDVAPGQVRLVVDPSGSSHSHD
EQQHVYPRGSKIPTWSSQFAGTARCNATFNPALLLELCGEMRIFEMMETPVVSDIEDALF
RINRPETYTQKLQAKARLIAIYVCTLYSVLVLVAIGLRVVLQHRSLYTTLNHILLGPIGI
WLCFASLNTPFVLFIAEAAATASILGSFENIVLPKKTRHVPKTANPNGGDDDGLVSNSMH
TTSGNNDSAEANTEVEDNPTHESDIYDFEDREKVRSEKASKQSAIRRSLEYFLVALRFRI
MRCTDAHASNSSTSSFGDDGHGLRLPVPFRSFRLLERLGSTTMLCCFDDDILCEQSPSVE
EIFLLNDKQGSSTVLDLHPERECETGLKFEDPKWKQHLPSLKPIGLAIMLNDTEDPASHY
HTSMKYLVNETLSNLDDASTGGVRDPYMRSCMQRLSAHVRMLPFPKHLLNLSREMGFVVD
DDLNVFQRRQSIHIICPRLAHHEHTTDHHDQGQDDMRYRGNLKTHLYSTVVQDKRTNRHQ
LLSRGHPTIALTQCSEYWDGKSICPLTSEKRRAILEMYNQWRVEDLDCVALSYVPVPHKL
NALFSRKNHSPDASMNASRFGSNKTDMLPPVYLVDDSNSGDVNASLDGAIPANGGFTYGG
DKFRNQLNVSPVASQCSADDKRFSASDMDATSNQYTSGSSVPIRSLSPTSRQRNPTGLVS
FSDVASSTAINPSETGSTERDSLLWRIQEDQIFLGMVATGVQPKKGIPEFIEDLTACGIR
FVYFSPRNMRRSKLLAEKMGIETDWNCAISLRPLDSDGPDPHRMTSNYSDWDVKARLPHG
VEAIKRHLAEVDNVPLLVSLYTDSTPETISEMISIFQENNEVVMGVGSSLKESNAPLFSK
ADSAAALQGGLQSFFDEQLPKGKELPVFSEEDIQFSHILNTLTCSFRINSKEDDVHAKDA
TPSLTHLIELIRLGRCVLTNFHQMIAFIFVSQLFIATLILISYIVPFPLVPQLSCASIFW
LLWILVPTLSLSMLASASEKDVMKQTPRKNEEIELQEDLPRLATYFLIRHVPSALLAIVV
FECLLGFSLASSRAQLGDEYRDFQWFDFMLHNSIVLARPRPPVVAAAVDRAEAGMLLLIG
ASILASSCGYLYRCESIFSMSPLRNRMWLGASTGLLVVQLTISMVRAGLAGSDGHSLWFF
IGEAVPWYFWTVFFVWPMIVIAVDEAVKSHDRHHMTRYFKFLRMQFDTRLGMWSPK
Download sequence
Identical sequences K3WDV0
PYU1_T003141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]