SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003149 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003149
Domain Number 1 Region: 177-227
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000179
Family Myb/SANT domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003149
Sequence length 524
Comment protein Name="PYU1_T003149" Note="Similar to mybJ: Myb-like protein J (Dictyostelium discoideum)" AED:0.111428571428571 QI:0|-1|0|1|-1|1|1|0|524
Sequence
MYSGGGDRSSPSSWQVQQQHEYAAPARQQQQQSQSGWFPLEDAALPQVQRDMLYAPPVDR
WDTVYSGRPTDRTAYAAPSPSAYASDPQAHHDGSAGLQLPGYAWTHDARITTAAVPAMTH
GADPFDDQFTHPYAASPVYPSDPPAPIVVHPYQQYPQQHQYHSMPTARRKAKEISIGRWN
ADEHKWFLKGLEMFQGPAWGEIARLIGTRTSTQVRTHAQKFFTRLARMNQTLPYFDAQIQ
KERLRLLAQGGANALVGSSSVTPTSTSGFNFALASLSPRKRVLGSSPHPNRRRGEDGGTP
NMATSPHYGSSMLPSSNMEYAMPKIGSYVDDHTAADRSGRVPASFNYYHHADDSSSSNAD
IYKPKYDQQYPNLNGEATSPLLRKPRIFTGAHMAPPPHTSSFDDVHSTSTYASLPTAMHA
KDALDSSRHHFAAIDGSPVLASRDDMAYGMLHAGSSNAAVDAGAADPWAQASSPRQWTIP
SAASSLHPDASAAAGNSSSSELLDANDSLPSMTKLLYRGNAAVS
Download sequence
Identical sequences K3WDV8
PYU1_T003149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]