SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003225 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003225
Domain Number 1 Region: 3-137
Classification Level Classification E-value
Superfamily DNase I-like 0.0000000000131
Family DNase I-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003225
Sequence length 156
Comment protein Name="PYU1_T003225" Note="Similar to Transposon TX1 uncharacterized 149 kDa protein (Xenopus laevis)" AED:0.0873015873015873 QI:0|-1|0|1|-1|1|1|0|156
Sequence
MVECAPIYIHNVYAPVDQQEKQQFFSSLETEEFEDQATHMVLGDLNTPLDPRLDSSSPDL
HYDPGRSSCLEWLAKLGVVDAWRIHYDTKRVFTGPLPRKNRLDYILLSEDFYTCFYDDSK
YFLPKHAGDHLAHSVSFRSGSQLHGRGYWKFPRYLL
Download sequence
Identical sequences K3WE34
PYU1_T003225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]