SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003249 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003249
Domain Number 1 Region: 91-187,341-469,957-1180
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 9.15e-38
Family Calcium ATPase, transmembrane domain M 0.032
Further Details:      
 
Domain Number 2 Region: 470-486,687-800,863-963
Classification Level Classification E-value
Superfamily HAD-like 7.02e-33
Family Predicted hydrolases Cof 0.057
Further Details:      
 
Domain Number 3 Region: 482-509,548-711
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 5.89e-21
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0058
Further Details:      
 
Domain Number 4 Region: 199-262,299-339
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.000000000000123
Family Calcium ATPase, transduction domain A 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003249
Sequence length 1433
Comment protein Name="PYU1_T003249" Note="Similar to ALA10: Putative phospholipid-transporting ATPase 10 (Arabidopsis thaliana)" AED:0.0269334247489387 QI:0|1|0|1|1|1|2|0|1433
Sequence
MDGVLPVTGTPFVRRDSIQSEISVESDVTYRSLENGDISAMVGGPHKLTNAEMLSSMGGS
TRSLVSLADQGGSGGVMLSETNSRVVFVNDAANNLLAGFCDNKVTTAKYTKLNFIPRFFY
GRLSQVANFYFLLVGGGQIIPAISSTSGVPYQWIVLLIVLSIDAVFAAIEDSARHRADDK
MNARVTQVFDPNEPTCFRESIWRDVKVGDFLKVCNYEAIPADILLLAVSEPDPNAPAGIC
FVETKSLDGETNLKVRQALSCTFSQLSDPRFLGNLPGKVICERPNHDVNNFSGRFEPQQG
HTIPIDLKNIALRGCVIRNTPYVYGLVLNTGGDTKIMQSASETPTKVSKILTIVNRGIGI
LMAILIALCVLGAVMCSVWVANNYDRSTYLMLSDLSGSAPFHNDIIGWFIYMGYYWILIA
SFVPITLYVTIAIVKSYQTFFLNRDMEMYDEVTDTPALVRNADLNDDLGQVTHIFSDKTG
TLTANEMDFRKMSINGVSYGRGTTEIGREAVRRLGKDLSASDILADNTPVDAKEDNVRFI
DPAKEYLRDSDPRLNPIQAAWIEAFLTHLAVCHSVVLEQGEDGLGTQFSASSPDELALVS
GANFFGYSFKARKNGSVSIRIPGQSQEVTFELLEMIDFTSTRKRMSVVVRNPEKKILLLT
KGADSVIFPRLDQRQCDPQIVEITNQHLERYATEGLRTLVIAQKEIPENAFAAWSREYKN
ALSDLDEVQKQKAGEPNRIEDLEEALEMGLELLGATAIEDRLQDNVTSTIADLSRAGIKI
WILTGDKEETAINIGFACQLLNNDMERLIINTETFPTADKLYDMLLFRCKEVRKLKLEGI
ASVSRSKAIIIDGKSLTMVFSHHTLCDLFLEVSQHCSAVICCRVSPKQKAQVVRLYKTNI
QGCRSLSIGDGANDVGMIQEAHIGVGISGHEGMQAVNASDFAIAQFRFLKRLLLVHGHWN
YRRMAKLALYVVYKNIILYCAEFVLGTISGGSGTLYFSNMWVNGYNVFWTSLPIAIVGIL
EQECPSYIAEKYPGLYYAGAQGEQFSLRIFAQWILEGLYEGVVCALVPAFLVGYVDSNGN
SFSRDACGGLSYCCLIMVGWAKLALNIVTWNYVTFAGFAFSFSFWFFAAFIISVYLPTFA
SDVAFPYIYGLPEFYLIIYLSMLLCLGRDFLYKAYKREMKPEYYHILQELNLRNLNPEKA
QWEPPELRYRQFQADLTEEKPQFEPVSEASQPASPQTFDRQRAYTGFAFSTQVLEDRFIN
PLREMVMPVNRMANAIGNKLGGIIHKDTDNEPVKSFEERIKELSMEEQVVYEIQRFQVFT
GWGSSLPGHLFITDPPHFTNAEMNDGSSTFDLTDWIVDNTFGGQDQWQYGTKFKDFLRDQ
EARNLPVKERRRLKKKLNKLVGRCVRRRRWVRRDKVITEMAEMVAMGAENLQE
Download sequence
Identical sequences K3WE58
PYU1_T003249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]