SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003271 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003271
Domain Number 1 Region: 7-209
Classification Level Classification E-value
Superfamily DNA-glycosylase 4.55e-42
Family Endonuclease III 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003271
Sequence length 209
Comment protein Name="PYU1_T003271" Note="Similar to NTHL1: Endonuclease III-like protein 1 (Bos taurus)" AED:0.0184331797235022 QI:0|-1|0|1|-1|0|1|0|209
Sequence
MRAREKMTAPIDQFGTHACVAPHAQSDANKRFHILVAALLSSQTNDKITHAAMQRLHEQL
RSPNDNEDNEDGNEGLTVAKVRATSETQLDALLTPVGFHRRKAQQLKQIADTLHAQYKDD
IPRTYTRLTALPGIGPKIARVILLVAWSEAADGVIVDTHVHRLAGRLGWARTKGSSERTA
EATRVALEEWVPREYWTPFSRAVVGFGQT
Download sequence
Identical sequences K3WE80
PYU1_T003271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]