SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003291 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003291
Domain Number 1 Region: 76-138
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000152
Family Centromere-binding 0.015
Further Details:      
 
Weak hits

Sequence:  PYU1_T003291
Domain Number - Region: 245-293
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 0.0131
Family Outer membrane efflux proteins (OEP) 0.035
Further Details:      
 
Domain Number - Region: 8-58
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0412
Family Paired domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003291
Sequence length 323
Comment protein Name="PYU1_T003291" Note="Similar to petC: Cytochrome c1 (Paracoccus denitrificans)" AED:0 QI:0|-1|0|1|-1|0|1|0|323
Sequence
MGKRGAGRRLNDQERMEILDLLAKEAKVKNVDLAKRYGVSEGAIRKLKQIKDTIRDRYVL
GNEHNRDKRKRGGFRRNAQFEQELYAWICRMRETQAYQLIPLTQTAVRQQAIMLAKNYET
MSTFKASPGWFARFCSRHRLDPPMNPGTSDGVTSMGAIAHSTTAVPESLLPVSAGLVGDV
VRMPEESEAALAMGFQSVDTIQTLVGGPAVDIGVVAAPVELEQPAVEKKDENPRAVDLNC
PEAIDEQAQTQAQLAAAEQAQAQAQAQLAAAEAQLAAAAAAVHEENAALSASLKAGEQVK
SDPAASQPENPQSPEPKREAEAL
Download sequence
Identical sequences K3WEA0
PYU1_T003291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]