SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003343 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003343
Domain Number 1 Region: 9-275,422-481
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.6e-49
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.00068
Further Details:      
 
Domain Number 2 Region: 264-423
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 2.54e-32
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003343
Sequence length 483
Comment protein Name="PYU1_T003343" Note="Similar to YEL047C: Fumarate reductase (Saccharomyces cerevisiae)" AED:0.0183766713700195 QI:0|0|0|1|1|1|2|0|483
Sequence
MATNDHGEHAPIDRKADITIVGGGLAGLAACIEVATRNPSLSIVLVEKEGKLGGNSAKAS
SGINAALNDDDAPVFEKDTLESGTGLAARSLVDVFVRNSRDAIAFLEKQGHVDLSVLSQL
GGHSAKRTHRNTQGPNVGFAIVSALQKLITDHIESHDWHIDVVTSASAEQVLFENDRVTG
LVIDRVDKTGRDEGAGEPLRETIESSVVILATGGYSANPELLKKFAPGVEDFPTTNGPWA
RGDGIGLAQQLGAELVLMDKVQLHPTAFINPKDRSAKHKFLAPEAIRGSGALLINSSGKR
FVNELATRDKVAAAILAQPSKDAYMLLFEGAKDMETTLGFYKHMGLVQVAHSIEEAAALC
HVDAFVLQQTLNDYAEVSHSQQPDAFGKTVFPHPLHYAEDVTSHMEIHVMEVAPAVHYTM
GGVKINEHAQVLRSDDSAIAGLYAAGEVSGGLHGANRLGGNSLAECVVFGRIAAQQAVQQ
LAH
Download sequence
Identical sequences K3WEF2
PYU1_T003343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]