SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003350 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003350
Domain Number 1 Region: 58-160
Classification Level Classification E-value
Superfamily Coiled-coil domain of nucleotide exchange factor GrpE 6.41e-22
Family Coiled-coil domain of nucleotide exchange factor GrpE 0.0017
Further Details:      
 
Domain Number 2 Region: 165-218
Classification Level Classification E-value
Superfamily Head domain of nucleotide exchange factor GrpE 0.00000000000000549
Family Head domain of nucleotide exchange factor GrpE 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003350
Sequence length 222
Comment protein Name="PYU1_T003350" Note="Similar to grpE: Protein grpE (Bradyrhizobium japonicum)" AED:0.0224215246636772 QI:0|-1|0|1|-1|1|1|0|222
Sequence
MLRRAVSQSLRLSRHQASRPVSTTSVLFNGEKPADAEPATAATPEGEPAAADASAAPVDP
LVKEVEELKAKNQELNDRLLRALADAENVRRISRVDVNNAREFAISKFAKSLLDVSDNLK
RAHESISIEELHPDHTLPAIKTLHEGVVMTDAQLQKVFREFNINQVGAVGDKFDPNVHDA
LFEYEDATKEAGSIGQLMKIGYLLNSRCIRPAQVGVVKATKQ
Download sequence
Identical sequences K3WEF9
PYU1_T003350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]