SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003359 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003359
Domain Number 1 Region: 108-184
Classification Level Classification E-value
Superfamily Cyclin-like 0.00000000000775
Family Cyclin 0.027
Further Details:      
 
Domain Number 2 Region: 186-257
Classification Level Classification E-value
Superfamily Cyclin-like 0.00000000473
Family Cyclin 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003359
Sequence length 259
Comment protein Name="PYU1_T003359" Note="Similar to fam58a: Cyclin-related protein FAM58A (Danio rerio)" AED:1 QI:0|0|0|0|1|1|7|0|259
Sequence
METVDGRRTQDASVLQELARNRSASGASSHTSEQASGKAEREDRDRIAMCEFAVRCATRL
LLDQASTLTALVLSQTFFTHRRKVANYKNRIPYAMERDNFVETYDRGYCFSQYDSRLIAG
ASVFISTKSCEVPRTLRSIANVVHAVANDTNEPMGTGSRYTNLKMSLINAEQTVLRVLDF
DVDVTLPFNYLFKYAAQLKLVASTTHCAVKLASDVYFDARALALPPFVVAAASLHIASKL
VEGQGVAQESKWWYLYDTR
Download sequence
Identical sequences K3WEG8
PYU1_T003359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]