SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003372 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003372
Domain Number 1 Region: 291-388,445-506
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.5e-16
Family Canonical RBD 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003372
Sequence length 613
Comment protein Name="PYU1_T003372" Note="Similar to Htatsf1: HIV Tat-specific factor 1 homolog (Mus musculus)" AED:0.320447840838054 QI:0|1|0.75|1|1|1|8|36|613
Sequence
MAAAADKELWLYVDAATGQQKGPLAGAILKRLLRKGLLQPQQFVWTQRLSEWQPLAQVDA
FAAYCATWCALWYYMVDDLDAGPSATKQAGPVATKELVALFLDGEIDGMTLVWSKDMAEW
SSISEVPSLKEFLHEANEDQAREEEVLEKQSQVAVEDQVFKDEKVEAFVAEDGKQYIFDT
EGKKWVTPEDKIEEDLQALREAAGESKEDHEVAQEVKQKKKNQANKNNGGDGVNKENENE
NDTTAAADNGESAKIASTASSADSTDNAEQRKPKKKKKKKSEKWQRSKNKTWVYVNGLPL
DITVQEVHDHFAKCGVIQQDLVTSTPRIKLYENKEFGGLNGDGSVCYMKEASVELAIQLL
DKSEIRPEWPIDVSPAVFEQKGSEFVKRKKLKLDSRAKVKKIEQEKALSWNEGGDGDKNG
LRIVVIKHMFTPEEIEDEAYENELRDDILAECLKIGEVTKITLFSKHADGVVVVKFESTG
AAATCLDVMNGRFFAGRKLECSFWDGTDYTYRESKDEENERAEKFSEWLEQGSSSSEAED
ESDDEDTADGKENVNEIGAAPSAATVHAGRVMPDLDDDDEEDDSEDENVPVAEAVHAGRV
MPDLDDVDDDEDE
Download sequence
Identical sequences K3WEI1
PYU1_T003372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]