SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003401 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003401
Domain Number 1 Region: 183-222,250-480
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 3.01e-24
Family Galactose oxidase, central domain 0.024
Further Details:      
 
Weak hits

Sequence:  PYU1_T003401
Domain Number - Region: 8-84
Classification Level Classification E-value
Superfamily F-box domain 0.00222
Family F-box domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003401
Sequence length 505
Comment protein Name="PYU1_T003401" Note="Similar to rabepk: Rab9 effector protein with Kelch motifs (Danio rerio)" AED:0.201455946365137 QI:0|0.33|0.14|0.71|1|1|7|0|505
Sequence
MAMAQRHAGFDDVSAEVLGAITELLPVDALLHLEQTSCHMRELLRETVAQRCKRECFTTY
LYPTIATYRMLAPVPETWKQLYFSFSKLGGMRWSVCQKEGTSSSLRSLKSDNQEYEVDDG
ARFLLRSGGHYWFSVWQTRVYDASLTTSSDAVVGGEGANANANSNSDAVPLAFLRSPRTI
SMGKWEKIRAVGQGPCPRRHHSMTCLPDTKCPASVISSSDATTQRGNGGDGEVTIRRVVF
FGGQSEGIPFDAFNDLYLLGVKRKKDTAKSSGPIQARWILTIATGTPPSRRSGHITTLLS
PTTLLISGGSDGTTPIKNLEVYLLRVEGYATFRWETPSSSISPSGRALHEVYRVASDEVI
IFGGRQVIRQSNGLLSLHRLRILAREDDADAAACEAYWSVPETTGDPPHPRRGHSTNVLG
DNLLLFGGQDMVTSQLENDVRVLHVPSLRWRRLELPGDAPCPRRGFKNQFFGTSLVISSG
FVASPATGKMDQQLPDADIHVLTIV
Download sequence
Identical sequences K3WEL0
PYU1_T003401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]