SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003416 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003416
Domain Number 1 Region: 134-504
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.02e-87
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000111
Further Details:      
 
Domain Number 2 Region: 40-140
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000536
Family Anticodon-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003416
Sequence length 506
Comment protein Name="PYU1_T003416" Note="Similar to asnS: Asparaginyl-tRNA synthetase (Protochlamydia amoebophila (strain UWE25))" AED:0.00587856119995211 QI:0|1|0.33|1|1|1|3|0|506
Sequence
MLGLMRGAPALGRQHQRTWSTATTTATTAAAASKRVVRSTINDVRQLDDGARVAVGGWVK
SVRKHKSVNFVNVNDGSCLAEMQITLPAADADEGASLDVNIADITVGSSLFVEGVLREVP
GGKQKRMELHPDTLNILGKCDAQVYPLQKKYHSLEFLRENLHLRARTNTFGAVTRVRNAL
SQGLHSYFQDNDFLQLHSPILTSDDCEGAGEQFRIAKPDGKNEFFGTPTYLTVSGQLHAE
MYACALSKVYTFGPTFRAENSNTTRHLAEFWMVEPEMAFAGLEECIESAQGAVQRSIKQA
LQACPDDIEFFNKNYDNAISERLQTLCDREFARITYTEAIEILKKCGASFEKNPEWGMDL
QTEHERYLAEKYVGGPVFVTDYPSDIKAFYMRRNDRDAEGRETVAGMDLLVPKIGELVGG
SVREERFELLEAKMRQLGLVPEELAEQAERSASGGSLDWYLDLRRFGTVPHAGWGLGFER
LVLFATGMDNIRDVIPLPRFPGQCQH
Download sequence
Identical sequences K3WEM5
PYU1_T003416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]