SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003447 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003447
Domain Number 1 Region: 3571-3639,3718-3855
Classification Level Classification E-value
Superfamily Thiolase-like 2.09e-34
Family Thiolase-related 0.0035
Further Details:      
 
Domain Number 2 Region: 1606-1659,1711-1787,1909-1930,1974-2047
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 4.36e-34
Family FabD-like 0.0013
Further Details:      
 
Domain Number 3 Region: 3385-3610
Classification Level Classification E-value
Superfamily Thiolase-like 2.58e-30
Family Thiolase-related 0.0014
Further Details:      
 
Domain Number 4 Region: 3989-4115
Classification Level Classification E-value
Superfamily 4'-phosphopantetheinyl transferase 1.57e-20
Family Holo-(acyl carrier protein) synthase ACPS 0.0063
Further Details:      
 
Domain Number 5 Region: 71-227,337-444
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 2.88e-19
Family FabD-like 0.0043
Further Details:      
 
Domain Number 6 Region: 2888-3102
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 9.09e-19
Family Tyrosine-dependent oxidoreductases 0.017
Further Details:      
 
Domain Number 7 Region: 1490-1600
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 1.33e-18
Family MaoC-like 0.014
Further Details:      
 
Domain Number 8 Region: 509-628,659-746
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 0.0000769
Family FMN-linked oxidoreductases 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003447
Sequence length 4119
Comment protein Name="PYU1_T003447" Note="Similar to FAS2: Fatty acid synthase subunit alpha (Saccharomyces cerevisiae)" AED:0.0214323777615809 QI:0|-1|0|1|-1|1|1|0|4119
Sequence
MSDGKIDTTTMTSATSSITTTGNTTIEVTTTETIVTETQVQTEEVVETTTTTTTEEISAV
VQALNAGKRKVIVEYGGQGIEYWQELKALYQQGGAVRAFIDLAADALYEESSTEQAKTSP
AFELVLDLKTWLQESDDEATKEPQNVAWQRAFFSYALIALTQAANYVSFLTTAKVSHADV
VKSASCAVGHSQGIVSAAVFATAKTDEEFSEISVRFVRYMFWHGLRAQETFLEIVAQQKK
NVKVDKDATPMLAVRGLSKEHVLKAIEVANRRTKQNDLQLSLVNAPEMFCVTGLPATLLL
LKQALEPLLAKPDENQTRVPFSQRKPTGALVFLNLTCPFHSALLAPAKEKILADAARVNV
KLTGAQLQVPVYSTTTEATNLQSFGDADVLPQLVEMQLIQLADWASTLKTIRSSHSDATH
VLDFGPDLGASRLSNTALEGLGIEVVVATSKYATFESSSRFPPIFGLSQFVDNVAISSSG
AKSWEEKFAPRVDETGKLVNKFTRALKKPPVIVAGMTPTTSLEGVDLVAAIMNAGFYGEL
AAGGLSRPNVFEDTITELVSKVQPGHGIAINMLYLNAKQWGFQFPMVLRLRKSGVPIESI
TIGAGIPTKDRALEIMADLQAAGIKVIGFKPGSAEGIYSVIDIASANPSMNVMLQWTGGR
AGGHHSFEDVHHPLVATYAAIRRVENILLVVGSGFGNWEDSHQYMTGEWSLSRGLLTKMP
VDGILLGSRVMVAKEAATAQEVKQLLVDTPGIESELEWEQSYTGVVGGIVTVTSELGEPI
HKVANRCSLLWKEFDDKYFSKPREELALAVRLDKDDIIARLNADFQKPYFGVKKDEESGD
VRSADLEEMTYGEVLTRLIDLMYIDIEGRPQRWIHESFRDRVAKFMTRTEQRFRRKRNSK
SFDQSELKTNPRNALRTFIEAYPLSISTLLSVSDCDYFLDLCRTGGKPVNFIPIIDSELR
TWFKKDSLWYSEDLDAVPERDAQRVCILQGPVAVRYSTVVNEPVASILGGIADGFIKVAS
ESGARSATSIASVQKPAEVSGFPVVENDGSFNVTVPADVSALPSASDWLAGLHSLTIDNE
WLSSLISSEFVVESKKWIANPIRDLLKPQPNQTVSVGADGLKVVDKSVLLTGPVIQVFKQ
DAEIVVRVNELRPQITELTEGVVALDMKFNFVPESTWSIHSQDSDLTEKIKSFYARFWVA
EEGKEDESCKQACEESVFSSFTNEFTVTADDVIKYKAALNLSGDEVAAPADFSTIVSWKS
LIKSVFAKEVEGNLLNLVHLKHSYKLLTTEKANQLFAPGDEIVSVANVAGLRIIESGKIV
SGIVLISRKTVSDQMVEALEPLVELRSEFLIRGKFSDFSSAFTVDDTVECITLTRKDDVQ
LLVSKPWLTVLPDAAPVVVGDILEFKLNTKKQYATMNELASVQVTGAVYRLESGATVHIG
DVKVDSNSLNGCPVETFLRQIQPKPANKGSMLPGGGYNMLSTPIEIQVPANALAYAVASR
DLNPIHRSNYAAILASLPKGKPIMHGMWTATKVRALVVEQFGSGVDTNVMEYDVNFDGMV
YPGDKLYMQARHIGQNAGKKVLSVEIVNELGERVVSARAEVKQPPMAFVFTGQGSAEVNM
GMERYQESPVAREIWNRGDAHLRDTFGFSILEMVRKNPKSITIHFGGKRGKKIRENFMKL
TVEDPVNGGTAPLLPEITPRTQSFSFSAPEGLLFATQFSQPALVLLEKATFSEIEAAELI
PEDALFAGHSLGEYAGLSSFAGALAVEDVAEVVFLRGLIMQKAVKRDESGRSDYGMVATN
PSRIGDFFTEDTMYTLVDRISEVSGKLLQVVNFNVQDRQYVVAGENVNLEALSTSLSMFK
SLKASANLESVVQEALAQAAAKKEKCIQSGKPFTLARGLATIPLPGIDVPFHSRELLGGV
PSFRSLLRTKFSPDVLERQLPLLVNRYIPNLVATPFSLKRSYFEQVYEATKSPYIAEVLD
PMQWNLTTKAQLVHLLVVELLAYQFASPVQWIKTQALLFSLNGTGVDRFVEIGPAPTLTN
MALRTLQVGDFPDAPRQILWYKRDREVVHFEEESSNPSASEYARALAEAAAALEAPVVEA
AAEPEVTVVAVAPPAAVHMPAPVVHAAPAAVEDAPVSALHILRVLLAIRLNKELSEISAD
TDVKTLCAGKSAVQNEILGDLEKEFGAGVPDGAGEIPLKELASKFSGYSALGKVTTGLIS
KMIAGKMPGGFTMSSVKEYLVGTKALGSGRIESVLAHSLLLAPQARLKSEAEARKWLDAS
VDSYASFAGVSLAAPVMNIPQAASGMTFAPASVSIPTVADSQVEAKHALKILLAAKFGKD
LSEISDASTIKELSAGKSAVQNEIVGDLEKEFGSGPDDAAEMKISDLAGKFPGYASPGKV
TSALIAKLLAAKMPGGFGLSAIKEYLSRERCLPAGRIESVLLHTLSQNPKQRLADEGQAK
KWLDAVTDDYAKFSGIDIPYLSKLGMSAGAVSQQSMQTAALPTDFDKKLKAMIADQVEAL
NNYLGTESLDWHRRVETEVELREQMESSVSHWVSEHGEAYGNGIAPMFDARKERQYDSFW
NWAVQDAMELYFRTILAAMGSDSAEKLPVSERLDEHFDAMSRWINKKVDTITEESARPPL
EWFKPYLCNRATPELLKYTRYFVQRAEHEGRVEYSQAIQLLVEQVETWLQLNPVNVQIFE
PMQPQLRILESGEMEYLEVPRTGVSDSIDYVDELARGLEYNDASQTTLYAGADATAEMAS
AVGFETTLNEGDSSDEDESDDDEDSDEAQVAGQEQQKAPAQVKPADGPKLNALRESLRKR
GKKSPTRKSLVARSSHLRTGLNENLKQIVLPHIHIRKPSDVDPTIRLYDVESTCMLLACM
REMASTGISFAGKVALVTGCGKNSIGAEVVKALLEGGATVFVTTSSFSSKTTATFRSIYE
QHGSRGSRLVIVPFNQASKNDVEKLVAHIYNVHKLDLDFVVPFAALSEVGRTIADIDARS
ELAHRIMLTNTMRLLGEIVSAKKSRGISTRPALAVLPLSPNHGNFGGDGLYAESKLGVES
LMNKWYSEGWDDQLSIVGAVIGWTRGTGLMSGNNIVAQGVEKLGVRTFSTTEMGFNLSAL
LHPNIVDKAAEAPLWADLTGGMAQLADLKNQVDTIRTKITSEAKLQASIYQSIQNEKKLL
ALPSVATAEQQPAFTPRADLSGYFCDGFPGLSSVGRLASTREQTLLRDMLDLRKVVVVAG
YGEVGPWGSARTRWEMESFGEFSLEGCIELAWLTGHIVYDNGNWVDAKTKEIIPDSEVKS
RYEEEIIKHSGIRIVEPDLFEGYDPHKKMILHQVAIDKKMAPVEVADREEALQFRSELGE
ENVDVFQNASGAWMIRLRKGSVLSIPRALSFDRFVAGQIPTGWSAERLGLPKDIAESVDP
VTLYTLASTMDALVSAGVTDPYEFYQYVHVSEIGNTSGGGMGGMRSFKRIYQGRLQGKSV
ASDTLQECFINTAPAWVNMLLLSSSGPIKTPVGACATAAESVDIGVETIKSGKARIVIVG
GYDDFGEEGSYEFAQMKATSDSVKETGMGRDPKEMCRPCSTTRGGFMESQGAGMQLLMDA
QLALDMGCPIYGIVALTNTATDKNGRSVPAPGQGILTTAREASSKPSPLLDVEFRRRQFD
AEVADVETWFSREKALVSEDNAESHLAFLDEMKARKLQSAQAMWGEGFYLGRADIAPLRG
ALGVWNLTVDDIGVASFHGTGTKANDKNESEVTQKQLQHLGRSVGNPLPIICQKNMTGHP
KGAAAAWMFNGLLQVLNSGLIPGNRNLDNTCETLRKFDYLMYPNRSIQTVGIKAAVMKSF
GFGQAGGEILLVHPDYLLSTLAQGDLQSYTSRRSKRLTRMNTYMQNTVTGKHSFIQVKDS
APYSASQESSVYLDPTSRAQYDPVVKSWRFGGSDQDRRPRAPKRAKKTKSFVISSTSKTV
DEESGSDPSTLESALNQTASDIGLTARNIGIGVDVEPVATFENLHGREDFIRRNFTDQEM
AYCYSAPHPAASFAGRWAAKEAVIKAISSTSPNEPNVWKGAGAPLREIEIFMTASGAPSV
LLSGYPLQVFNRIGLTSLSVSISHSGDYAVSQAVANFQS
Download sequence
Identical sequences K3WEQ6
PYU1_T003447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]