SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003458 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003458
Domain Number 1 Region: 152-215
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000421
Family Centromere-binding 0.0075
Further Details:      
 
Weak hits

Sequence:  PYU1_T003458
Domain Number - Region: 90-144
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0412
Family FIS-like 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003458
Sequence length 362
Comment protein Name="PYU1_T003458" Note="Similar to CENPB: Major centromere autoantigen B (Cricetulus griseus)" AED:0.246556473829201 QI:0|-1|0|1|-1|1|1|0|362
Sequence
MASAPIAAAAVPTGSAEKKKRIVLRRYVAQEEKEKELQLKQQRKLLLAAAAAKPFAQEQQ
EEASLASPQQQQPTNVPESAEKRKRGGGERLNDAQRLEIIRLRRQDNPPSLRSLAREFRV
TEKSIRNVMQSAAEIEKRNENVDVKQQTQTFRHAAPRHPELEEKVFEWICSLKKVQINPT
PSAIIEKAKVIAAGLGIADAEFKGSAGWFERFRRRRRLSDMRMSVGGDDGAGDNDDDEEN
RDGDEEQQQSNDVSGNSAASTKRRNEHSVALAGSSNESVVGAVGVYDLLHRLVEFENNLR
LFQRANPLEHDRAEQCLANASVIRHDLLAMHANMQVRTLRANNGASPQTTKSTRHHELQA
LI
Download sequence
Identical sequences K3WER7
PYU1_T003458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]