SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003587 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T003587
Domain Number - Region: 91-131
Classification Level Classification E-value
Superfamily eIF4e-like 0.0745
Family Translation initiation factor eIF4e 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003587
Sequence length 227
Comment protein Name="PYU1_T003587" Note="Protein of unknown function" AED:0.607251593108331 QI:0|0|0|0.5|0|0|2|0|227
Sequence
MPRFTSTKTSKQGTYQIPSLDNLSPRNNYVTIQTPGVVAGESLDNQDVYTCLTPTHEKDS
AVCCENAHEDEVYVNDSNGLRMHAWSSALNERKLSASYFWFARCCPCIACSFKCGVLSYF
ISQATLIALWLLLGATLWSYLTGNGDSIQWTVAAIIFSIVQTVCIASRIASLRAKVRARF
AIPGSLKHDLQLAAFHPTHSIFQMGKHLACDRVHPCSAPTMLPAYEV
Download sequence
Identical sequences K3WF46
PYU1_T003587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]