SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003640 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003640
Domain Number 1 Region: 81-126,154-322
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.47e-37
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.0018
Further Details:      
 
Domain Number 2 Region: 369-679
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.32e-31
Family Extended AAA-ATPase domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003640
Sequence length 723
Comment protein Name="PYU1_T003640" Note="Similar to Mcm9: DNA replication licensing factor MCM9 (Mus musculus)" AED:0.179515362993118 QI:0|0|0|0.5|1|1|4|0|723
Sequence
MDGDADQVGGDLGVANVNAATFEARAKEYQAAFRSFLDACYGSDVAQLQRSLLGGSAMTT
MTTAALANVQQSDAQQQSFAFSLRVCAQALLDFNPSLGTLLFRHPDQFLPLFHAALAQQV
TAAAMVLPSASRRLSNELAGAQGFAAVPLKAQQKLKVRIEFLPPVNPLRKSTISTIRSND
VKQLIQIAGTVIKMQETSREYQCSNSRCQYRFLVKSDPEQGNILEIPKVCPSEGSKPCKS
TQFDIVEGSRVVSDHQVIKIQEQVSKLGVGSIPRSILVVLEDDLVDSVKAGDHVVVVGIL
MRCWRPCIKDIRCDLETIVKANSIRIKNATSAHVLVTEELKKEFAHFWQVTHARDPMRGR
NEIIASICPKVYGLFIVKLGVALTVIGGCSHVNETGMKTRGEPHMLLIGDPGTGKSQFLR
FTAELSPRSVLTTGIGTTSAGLTCTAVKDGGEWMLEAGALVLADRGVCCIDEFSSIRSND
RTSIHEAMEQQTLSVAKAGLVCKLNARTTIFAVTNPKGRYDPNADVSVNTAIGSPLLSRF
DLILVLLDRMNANWDEVVSSFILQQSTGQGGVHAKQEAAPRDRADDDGDKKNVKDDDLLW
SIPKLQAYICYVKDKYQPQLSRSAMTILQRYYQLQRSSDTRSAARTTIRLLESLTRLAQA
HARLMCHEDVQVMDAVVAVFVMEVSKATDNCSTMLEGGLESVLHSDFADDPSAERKWCSI
ISG
Download sequence
Identical sequences K3WF99
PYU1_T003640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]