SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003656 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003656
Domain Number 1 Region: 353-432
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000672
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.047
Further Details:      
 
Domain Number 2 Region: 240-329
Classification Level Classification E-value
Superfamily Bet v1-like 0.0000797
Family STAR domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003656
Sequence length 701
Comment protein Name="PYU1_T003656" Note="Similar to SRP40: Suppressor protein SRP40 (Saccharomyces cerevisiae)" AED:0.084045584045584 QI:0|-1|0|1|-1|1|1|0|701
Sequence
MAKTARFDQVPFHPLVLSAAECEKLQALATKELDKTLRVYDDAGPPGARAFRSSRWKTIK
TQDDCTVYLDRDSRARSTSTSSIRDSRTSTGSTGSTGSTGSISASSSSRSAKRSDPLQSL
MANGMLGGGAPPPRARRSSRDNAAPSPMRRRSTEGDYSAGSNVWEIPDLVVSGTVSGTLD
DIMYGTTTPDSAEMMLRMSYVDDNLLHGAVLAQIQTPTITEPFRSLVVKWYVKAIPSQYQ
KLVRPRDFVCIEASGILTRPDGSRVGYLLRQSVDLPSCDDLTNRGMTRGRVANCAIFTPL
PNNTVDIFVRGNVDPGGKMASSLAISIAASALLSSSSSVFCAHNKKLLWLLRNQKRDSAS
LSKSSTRSPTFACGTCAKKFHKLSSVSTCKICFMQLCSKCRLSKTLSYVETQTYQSVEQV
AAIVCKNCVAQANQMSAFDVAVREIASGRYGSVKDERKEQVKKDRLVQPAIPIHLNEPVM
RHQEQNLNQSQVRNSGALSPTGFRASSLFRASKILSASNRSTQKFDPNTSSISNFSLSIA
LTESSSRDSEISNFSCDWDPEYDDENDIDDIADSNDSNQWIEPYTPTKYGGRSKDSHESS
ELAVRRADAPSSHRHVPQQQQPQNHRGYDSEQAQRQALWQKMNALRMQAESTYNITQQNA
NMHMNGGSGREGVAYNDDRLYTHGGSGRGGVVYDADIDELD
Download sequence
Identical sequences K3WFB5
PYU1_T003656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]