SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003669 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T003669
Domain Number - Region: 136-190
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.00478
Family Leucine zipper domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003669
Sequence length 442
Comment protein Name="PYU1_T003669" Note="Similar to NCL: Nucleolin (Gallus gallus)" AED:0.12979683972912 QI:0|-1|0|1|-1|1|1|0|442
Sequence
MATTADAPAASSAKTKTKAAAAGGFPATATRGKRGARRQEQTEETASDSQEDDGVDKNLV
NAAVVAQDGKRSKRKRPLATQDNPHVSNTESDIEEDGELVHTDDTKVSDEQEEKGEAVAE
KPRRGRRRILHDEEQRKQRRKNQCKLNQRRYRARQRGMISTLSLETDTLTDYIHELEAYQ
QFLAKYNQQTDMAADACSHTRDARPFLVIDQFFQFFQHGFALHSVEISEIQERFLRFISA
PQLVSQGATKAGIDALLLQLKRYTSYHAVFEMHARSRRVVHSPYKQQQDDDARDEPRDTS
DKAGAVTEADGATATGPSCSWVIQVYGKMHLRLSRDTVMLVYPHIVQDEALSYRVVGHEI
KPTFSVIFQFDEHGKMGKLELMVDFAGAFMRLLNSAKQAAMLLGKALISPHCELGIDPHE
ESVAATAGTTENKQLSLKFILL
Download sequence
Identical sequences K3WFC8
PYU1_T003669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]