SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003708 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003708
Domain Number 1 Region: 5-266
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.83e-73
Family Capz beta-1 subunit 0.000000302
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003708
Sequence length 292
Comment protein Name="PYU1_T003708" Note="Similar to CAPZB: F-actin-capping protein subunit beta (Bos taurus)" AED:0.0501185716314683 QI:0|1|0|1|1|1|2|0|292
Sequence
MADASDANLTACLNLMRRMPPRDIEQDLYNLTRVVPALTDELYQRVDQPLQAAIDPTNGR
KYLLCDYNRDGDSYRSPWSNQYDPAIQDDEGFYPSENLRELEIQANEIFDSYREMYYQGG
ISSVYMWDLDPGFAACFLVKKDVIDQRFVEKGSWNSIHVIEVQEMNDAAATSTNNGRGVL
KKATYRLTTTVLLAMKVNRPELGDLTLDGTLTRQTEKTLEFEDQFAHVSNMGRMVEDMEI
EMRSSMDGLYISKTREVINGMRKLQQGPSQGNAFVGELAGAVLKHGLKKAQE
Download sequence
Identical sequences K3WFG7
PYU1_T003708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]