SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003727 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003727
Domain Number 1 Region: 431-565
Classification Level Classification E-value
Superfamily GAF domain-like 3.05e-24
Family GAF domain 0.062
Further Details:      
 
Domain Number 2 Region: 262-328
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.06e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0019
Further Details:      
 
Weak hits

Sequence:  PYU1_T003727
Domain Number - Region: 39-216
Classification Level Classification E-value
Superfamily Bet v1-like 0.000128
Family STAR domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003727
Sequence length 697
Comment protein Name="PYU1_T003727" Note="Similar to Hgs: Hepatocyte growth factor-regulated tyrosine kinase substrate (Rattus norvegicus)" AED:0.18639787856366 QI:0|-1|0|1|-1|1|1|0|697
Sequence
MVRSLPLRSGFFTAPQVTLSDENDLLLWARALVPDLHHPEAEWTLLQEKKGVQVMEDRQK
GGLTYSIKSVATVKASLDDIMELFAAPSTAAFKTLMQLQLRECFADAAVLFQSEQNESET
LAIKWLAMRNKKSAINPIVHLHDFCVMEYTGVIGADAIGGDPDKPIGVCVYESIEQMECP
PLYESHKLERGSLSKCGYLFRPREEGVVEAQFVCSVRQPPNKSSKRRMNRSLLLNWAESV
GMIEESISRKRISRELTLRRQPTWVHDKDRQCCHLCLKTFTNTRRKHHCRACGEIICRSC
SLYKSVDLQSVGLTTLRVCKACMDGTKIDKDSQAATTPNSVSSSSVDKELVLPKGVDDEK
LRDAVEEYALALPSQQSQVSTVPDLVGMAWLRQIAARDPSKKDMVADLMARLRLESQEKY
AVQGEKEEQVDIYDTLCDLAAQALSCKYAVVSLIDENRQWFKSAVNVRESDVPRDFSFCE
YPVRDQRPLVVMDALRDPRFMSHPFVTGPLAVRFLAGAPLFTVDNECVGAVCVLDTEPRH
TLQENQVATMQNLAHLAMVMVQERREAQHKFARAAATSQIVPRSHHQMHPLHYNQHPYQQ
QQQPPQFHPNYSVGPQHGYNGGHNISVSSSDMVPLSSYSGESSMIVQAKPHEAPREDPVL
KEQMIQLLQKASQVRDQVNLQSQTNNAQHAGLQSSGE
Download sequence
Identical sequences K3WFI6
PYU1_T003727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]