SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003734 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003734
Domain Number 1 Region: 241-374
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.67e-21
Family cAMP-binding domain 0.0048
Further Details:      
 
Domain Number 2 Region: 377-447,489-543
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000000196
Family cAMP-binding domain 0.011
Further Details:      
 
Domain Number 3 Region: 23-82
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000219
Family Ubiquitin-related 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003734
Sequence length 647
Comment protein Name="PYU1_T003734" Note="Similar to PKAR: cAMP-dependent protein kinase regulatory subunit (Debaryomyces hansenii)" AED:0.0525836375319579 QI:1|0|0|0.66|0.5|0.33|3|2|647
Sequence
RSERDLRFDVFFQLPNLIEPQNLRVHCSISLITLQATLQREFGIPFEDQRLYLHGDLLEG
DEDLAFYEIHDQSVITVRSRKRYRSIGDIFTKIKTVQFNTKTHPEDFELVEVVAALPPLR
IVFRRLAIIIAYITTLDRMQFMKTNRHVWKEHVSFWDERRSSVVAVAAHANAFSSCTSST
NNALRRNPQVGANTLTIAAIQCPAASTASQTANTSFVMRKCYPENVSHLLSHAHNIHKRL
QLPPESRSGADVHHIRKWLSSIKYFANASLPDAAYHDVAKHSVYARYKSGDYIFRQGDVG
EFFYIVISGCISLAAYGNGFFATMTPGTCFGEISLFEAKGVRTASANVNFAAPYAELAVL
PGEVYRRAINPFKQAVLHNTEKAVYSIPQLRPLPDNVLTHIAYASKTLTAKTGKRLVSHG
DELNVLVLLISGEVKVATPRPRKQSVVTLTTTTDASHTSPSTARSYACGSSKFKSSLNQE
ASEPYYPIVTVVHAPAVFGQEGCLSNTPKPAPWDIDAIDTCTIVCLRMDTISIFLAPRQD
IIRSLACEHQCRVEDFKRRFAHHQQQQDAVRHQTSLVHKQASYLWLLSSTKKLFALDTNG
ADRAAAGQQQKQQPSSSQIAFPKVLMKDEHTSRPWHSEADKVPEHLQ
Download sequence
Identical sequences K3WFJ3
PYU1_T003734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]