SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003767 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003767
Domain Number 1 Region: 106-218
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.28e-27
Family Canonical RBD 0.0034
Further Details:      
 
Weak hits

Sequence:  PYU1_T003767
Domain Number - Region: 44-83
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0131
Family Mitotic arrest deficient-like 1, Mad1 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003767
Sequence length 239
Comment protein Name="PYU1_T003767" Note="Similar to pabpn1: Polyadenylate-binding protein 2 (Dictyostelium discoideum)" AED:0.0460227272727273 QI:0|-1|0|1|-1|1|1|0|239
Sequence
MAEASNVDLEQLEAEAAQMEEPAPASSAVDATAAPAAASTDADSVAAVDAEIEDMKRRVK
EMEEEAAKLSEMQSQVETQMGKNTASSLSEMHAGGAGGAAAAAAAQQVMDDNSIYIGQVD
YGSTPEELQALFQSCGTINRVTILCDKFTGQPKGYAYIEFASRDAVESAILLNDTMFRGR
QLKVTPKRQNVRGYNFSRGGRGGGRGGRGGRGRGRGRGPMRGGFRGGRGGGGRGFHPYF
Download sequence
Identical sequences K3WFM6
PYU1_T003767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]