SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003788 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003788
Domain Number 1 Region: 626-685,759-813,860-905
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 3.37e-21
Family Archaeal tRNA CCA-adding enzyme substrate-binding domain 0.097
Further Details:      
 
Domain Number 2 Region: 460-606
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.0000000000000112
Family Poly(A) polymerase, PAP, N-terminal domain 0.051
Further Details:      
 
Domain Number 3 Region: 368-396
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000032
Family SIAH, seven in absentia homolog 0.019
Further Details:      
 
Weak hits

Sequence:  PYU1_T003788
Domain Number - Region: 317-348
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000105
Family SIAH, seven in absentia homolog 0.021
Further Details:      
 
Domain Number - Region: 257-342
Classification Level Classification E-value
Superfamily Type III secretion system domain 0.0785
Family LcrE-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003788
Sequence length 966
Comment protein Name="PYU1_T003788" Note="Similar to PAPD5: PAP-associated domain-containing protein 5 (Homo sapiens)" AED:0.170219290501837 QI:0|-1|0|1|-1|1|1|0|966
Sequence
MAECAAPPWRPAPATTPQKPPRAAAATRRDGENSGAVCNSSCSPCPSAASNSDDPVADDA
DAKERKKKHSGPRKRRPKKKVEAPANTSSNSNNMTSPTAVLVASTGKQHGHETPPPPVRM
PTMPDELETLLQAELMVKNVADTMDAATKKQQQRMRYAPANAHMRNPYDVDQRAGAIGFA
LPAAAVQPGDAYSQRQSYAPHYLHPASLRYSQSPPPPASSGAAVAPFDYGDQYHQYDRSY
WTQWVIEAAEKERTRRLNVLRQLQQEEEKEVQRRRKWAIAAIEREQEAMMREMFLDNMKN
TQWFQSTISRFAEDYEVVCPNSWFGCMHSCMLKDLESHVESCVYRQVPDTLDQAREDSVG
MDFYTYDVVCPNAVLGCNEICSRENLAEHLASCPVNGISREKEWEERLEGRRNVLLATEE
ERARRMSEQQQQTNSDSDGRFSFGHLQRLYEEQTAMMQVVLHDEIMDFYEQQEHEALQLR
PWITQAIDKAKYAIQDLWGPKVQVEGYGSFATQLHGGYSDVDLVVFGVTEENKMTCQQCV
GALAAHLTAQTSKKFVEISAITRASIPLLKVVVLVNATHPEGAETGSEQVLRIPFDITFD
DPIGLFHNGIASAALISKLSDHFYGLRELAFVLKHFLAKRGLNDPYVGGLSSYGLLLMII
FILLEQGALVSSVVDPLGHESDRKEASTQVRDESCNLQDHSQERVVSPRYEAQREKGEKV
AQEIIRQSITRQQLKQDSSNGAAVVRRKARRPHLPSLLVDDDDGEHDAKPYLLGKYLMDF
LQYYGNDFRQNVDVIVILGLDSSLEMETPAVSPGSGRSSFAAVSPPVSSHAMSPPPTLRS
PPPSIICAPLSATFSPLMSPASPHPQEGYLMIRDPLQPENNVGKTCYRVSQVCRDFSDFL
SFLTALIVRGSVMTTGKKKSKCRARNETDAADQQPRKPSYRILTSIFEMKTRETRASMDL
TTSSSS
Download sequence
Identical sequences K3WFP7
PYU1_T003788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]