SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003804 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003804
Domain Number 1 Region: 43-134
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 0.000000000383
Family Lambda integrase-like, catalytic core 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003804
Sequence length 144
Comment protein Name="PYU1_T003804" Note="Protein of unknown function" AED:0.088801085568327 QI:0|0|0|1|0|0|2|0|144
Sequence
MVLEAVQQARFSRQGQSAIPGVQNGSVWRSEQKVLVALFLVGHHKSTGAPTDSLLCKVTA
ANNLQVRDVTSTIKKAASLASEDPSRYGSHSLRNGGATALFNAGTDSLAVKQFGRWKSDV
VKRYTAIDGRLATRMAHTMMRGHA
Download sequence
Identical sequences K3WFR3
PYU1_T003804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]