SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003862 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T003862
Domain Number - Region: 348-413
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000345
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.021
Further Details:      
 
Domain Number - Region: 217-309
Classification Level Classification E-value
Superfamily Bet v1-like 0.0549
Family STAR domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003862
Sequence length 429
Comment protein Name="PYU1_T003862" Note="Protein of unknown function" AED:0.0197431608482167 QI:0|0|0|1|1|1|2|0|429
Sequence
MKFTLPEGAFPPLNLTQDDEQAIADLADRIVAETLQVNEEFIAGNRKLSKQEWKLIKTKE
QVQVYRQRKQKDGSVQRPRLLSGTILENHLNENNYSDSSGSASASTSGQSAEKPKSLINA
QHSLSSSSSSQRTSDSIFSDGIVDDAKPEHIPFTIAHGLVPGTIDDVSFGMFGNTEYTWR
LRHSYNSENAFDGYKILATIHSPTRDDPFRFLGIKWLSRPFNAFISRRDFVYIEATGMAL
DSNGERVSYHLMHSFELKQIPELHTSDIIRGNVSTCYIARQRDVSTAEVYCRAFIDLRGE
LLQSVSASVHTDFLLGVASVVDCSYVKKLAWQMQRSRRSNSQIEKHAPSKTCEMCSKSLN
KLGMFASGSSCQICRKMLCGKCAVERKITVDISVDVTQKDFSFCVPCVIEAKKLSAWDIA
VSNLPPGTE
Download sequence
Identical sequences K3WFX1
PYU1_T003862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]