SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003905 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003905
Domain Number 1 Region: 439-511
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.00000000183
Family DNA polymerase beta, N-terminal domain-like 0.0023
Further Details:      
 
Domain Number 2 Region: 206-281
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.000000157
Family DNA polymerase beta, N-terminal domain-like 0.0048
Further Details:      
 
Domain Number 3 Region: 313-390
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.000000262
Family DNA polymerase beta, N-terminal domain-like 0.0035
Further Details:      
 
Domain Number 4 Region: 99-176
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.00000549
Family DNA polymerase beta, N-terminal domain-like 0.0027
Further Details:      
 
Weak hits

Sequence:  PYU1_T003905
Domain Number - Region: 30-70
Classification Level Classification E-value
Superfamily ENT-like 0.0392
Family Emsy N terminal (ENT) domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003905
Sequence length 516
Comment protein Name="PYU1_T003905" Note="Protein of unknown function" AED:0.0621217776872872 QI:0|0|0|0.66|1|1|3|0|516
Sequence
MLRTENKMKGPKPQRVSQFLSKCEKENIELPQKSYEALLEAGNALKSCDGKEEDAINELK
KKFGVSNKRNQPGDNQGDDGESEEMPHHKRIKLAEEARERPAVCPENQKIVDAFIEYGVS
QLEQGHTGKGVTHLRAANTIRDYDQVIKSGVEARQVGYVGDLMARQVDEILRKGKIVDNE
PELNASRRDYDHNAPQIVQDLRNSPAKVPANQKIVDALAEFGEHELHYGNTGKGVSHLRA
ARSIQGAETEIKSGQQARYEVDFIGDVMIGKIDQILAHGKIVHDEGKTYSGTERVRGDPA
PIVQDLLDNPAKRPENQKIVDALRDYGDVHLSSGHRGKGISHLRAAKEIRSSEEVITSGK
QAQRVGMVGQQIAKKVDQIIHQGHADSDEDYEPGDEEGYDEVEDEVGDNQQDYGEPRSSD
SSKGDAPPIVRDVRNSPTKCKANQPIVDALVDYGESELRQYAHTGRGITYLRAARQLRDY
NEEIKSGAQAKKIGMIGSKVATFIDQVLEKQQNDSK
Download sequence
Identical sequences K3WG14
PYU1_T003905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]