SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003932 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003932
Domain Number 1 Region: 57-266
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 8.83e-37
Family 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain 0.02
Further Details:      
 
Domain Number 2 Region: 423-601
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.05e-29
Family NAD kinase-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003932
Sequence length 725
Comment protein Name="PYU1_T003932" Note="Similar to UPF0465 protein C5orf33 homolog (Rattus norvegicus)" AED:0.0605339639671463 QI:0|1|0.83|1|1|1|6|60|725
Sequence
MYMSLLRRGACVKRPRRRMASVASIASAAVSAFPPVAAFAQQARGLHHFEAPRLADLVLI
RHGESEGNVARQRSIDGDDSLFYGEFQHRHSCNWRLTDRGRRQAAAAGEWLKKNGLVQFD
RYLVSEYLRAMETAGRMGLPDAKWYAEMLIRERDWGQMDLMSEQERMIKMQDELRRRDLD
RFYYAPPGGESLAAVAQRADRLLCVLHRECADKKAIVVCHGEVMWAMRTRLERMPQDTFH
ELQESGQMVDQIHNGHILHYTRKDPQTGEMAPYFTHMRSVCPWNEKLSPKGWMKIERPVY
DNEMLLAIAERVPRMIVSEEYIEKTYQQTSPRTSAQKKTSFPPVGGISPIDDPSDADIHT
TNAAGEVVYPPVLLPARPLLNLRKVVVVNKTSRFQHECELHGNTGEALRKQMSMRGFVYD
RLKASHDHHIAAVEDITSSLKEKGIEVKVVPANQLTHEAIEGSDMVFSAGGDGTFLKAAS
FVNTPIPVAGINTDPARSEGNLCCYKVDNVCNRFGYALDRLLEGNFQWRLRNRIRVGMVN
QDGYWYELPRYALNEVFIAESDASRPSHYNIGVDQHQRESQRSSGIIVCTGTGSSAWHYS
ASQIYREQVAKVLEAMNHTHTNETVTELTEAFNKENIFPEDSLDMGFVCREPIINATFGD
IRFRRGKVRRVSMRSLGWDMKVNLDGLYSVPLDYGVQAVMKIVDEPKYVLRTVDFSPLPG
SSSST
Download sequence
Identical sequences K3WG41
PYU1_T003932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]