SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003948 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003948
Domain Number 1 Region: 17-110
Classification Level Classification E-value
Superfamily Cyclin-like 1.75e-17
Family Cyclin 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003948
Sequence length 116
Comment protein Name="PYU1_T003948" Note="Similar to CCND2: G1/S-specific cyclin-D2 (Sus scrofa)" AED:1 QI:0|0|0|0|1|1|2|0|116
Sequence
MWDDACETTTIEETIQLGLKKEAKSRYVRDCDYMKEIQRHGMKLAWRQKICQWMFETGKA
FALSVDTVGCAVQYMDQFLCAESVDKIMMQLLSLVCIFSASKVHDSDPVTLVSPPV
Download sequence
Identical sequences K3WG57
PYU1_T003948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]