SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003960 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003960
Domain Number 1 Region: 36-242
Classification Level Classification E-value
Superfamily LuxS/MPP-like metallohydrolase 1.12e-61
Family MPP-like 0.000000351
Further Details:      
 
Domain Number 2 Region: 260-460
Classification Level Classification E-value
Superfamily LuxS/MPP-like metallohydrolase 2.67e-43
Family MPP-like 0.00000991
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003960
Sequence length 470
Comment protein Name="PYU1_T003960" Note="Similar to At3g02090: Probable mitochondrial-processing peptidase subunit beta (Arabidopsis thaliana)" AED:0.0384849486947227 QI:0|1|0|1|1|1|2|0|470
Sequence
MFSKVLRQSPLQAKGLLARAQSVAASVQNYPSYVLNAPATEVTTLPNGLRVASEGSHGET
ATIGVWIGAGSRYETAQNNGAAHFLEHMAFKGTTKRTQQQLELEIENMGGHLNAYTSREQ
TVYYAKVFKKDVPRAVDILSDILQNSKLDEAAIERERDVILREMEEVNKQQEEVIFDRLH
ETAFMGNGLGRTILGPIENIRNLKKADLEDYIATHYTAPRMVVAGAGAVDHSQLVDLAKN
AFGGLPTEPKVAPTLEPVRFVGSDVRIKDDEQPLAHMAIAFEGFSWTSEHAFPLLIMQTL
LGSWDRTSGAGINMSSKLGQVVAEKELAHSFMAFNTCYQDTGLFGVYAVADQYKLNDLTW
YTMEALVRLVHKTSDEEVALAKTQLKANMLMQLDGSSPICEDIGRQLLTYGRRLTPAEIF
ARIDAVDAAAVRAAADQVINDKEHALAATGPIHELPDYSFIRRRSYWLRY
Download sequence
Identical sequences K3WG69
PYU1_T003960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]