SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003962 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003962
Domain Number 1 Region: 383-516
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000119
Family BRCT domain 0.037
Further Details:      
 
Weak hits

Sequence:  PYU1_T003962
Domain Number - Region: 513-621
Classification Level Classification E-value
Superfamily BRCT domain 0.0807
Family DNA-repair protein XRCC1 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003962
Sequence length 633
Comment protein Name="PYU1_T003962" Note="Similar to Mdc1: Mediator of DNA damage checkpoint protein 1 (Rattus norvegicus)" AED:0.302475689969514 QI:0|0|0|1|1|1|2|0|633
Sequence
MPREAVEFVGVFAGDDTLSGENTPEGFQDMPGQWYSTLQRKRGAVDNAATQRDSQATQKQ
TEVATELVTQPNDDDGDGSKPPVFVYAPNSFGDDDGRNYSYQQEPEEEIDEDETQIMMSM
SQDREGLRTTHRKIEEEELVVSASGNPAKGTSNVTSDDEGAESDMSDDMLAQDGPIDGLS
SLAASFQQQESEAERDAVKKKVPVYVSRSQFQNTPTPSVEGESSSSGAETEVEEELDSDL
QRIQSVVSKAKEIATHETDIAMQKLTRLRSTSEHSTSSENVENHNDGKKPKRIRLTSSPI
SRTDDNDAKSTDASESTEQAQGRMKRAKHATTKAPKPSSAKNNKRTAAIIDNEESKNPTE
SDRVSQLTGGNSIEVGETQPSQLNAVNGKSHRKDQAITPPSQKRRLSHDSPGVLQKPEDT
IRVILTGIEPTPAIRKKIKAIANAVYEDDIEKATHVIAPKNQLKRTVKLLCGISRCQHIL
GMKWLDESARVGAALNEADYCLKDTNAQQKWHFDLHKTMYEFTPEQRRQLFVGHTVFITN
HKSVLPPVKDLVKIVECAGGKAEVKGSAGPSDLVITSEAALGVVSVQKSLVSANPQRIYS
PELILSSILQQHIDFEQNHLVVSPSSSKKRAPN
Download sequence
Identical sequences K3WG71
PYU1_T003962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]